SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000053552 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000053552
Domain Number 1 Region: 7-176
Classification Level Classification E-value
Superfamily E set domains 5.95e-81
Family Arrestin/Vps26-like 0.000000117
Further Details:      
 
Domain Number 2 Region: 178-404
Classification Level Classification E-value
Superfamily E set domains 2.66e-63
Family Arrestin/Vps26-like 0.0000000557
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000053552   Gene: ENSRNOG00000019308   Transcript: ENSRNOT00000056710
Sequence length 421
Comment pep:known chromosome:RGSC3.4:10:57276364:57284166:1 gene:ENSRNOG00000019308 transcript:ENSRNOT00000056710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTC
AFRYGREDLDVLGLSFRKDLFIATYQAFPPMPNPPRPPTRLQDRLLKKLGQHAHPFFFTI
PQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSIEEKSHKRNSVRLIIRKVQFAPETPG
PQPSAETTRHFLMSDRRSLHLEASLDKELYYHGEPLNVNVHVTNNSAKTVKKIRVSVRQY
ADICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTITPLLSDNREKRGLALDGQLKHEDT
NLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHITLPRPQ
SAPLYLSPLCPSAPREIDIPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDCDDQF
C
Download sequence
Identical sequences 10116.ENSRNOP00000026207 ENSRNOP00000053552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]