SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000056613 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000056613
Domain Number 1 Region: 371-559
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.87e-65
Family Regulator of G-protein signaling, RGS 0.00000745
Further Details:      
 
Domain Number 2 Region: 768-997
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.28e-65
Family DBL homology domain (DH-domain) 0.000000000978
Further Details:      
 
Domain Number 3 Region: 1001-1131
Classification Level Classification E-value
Superfamily PH domain-like 2.15e-38
Family Pleckstrin-homology domain (PH domain) 0.00000127
Further Details:      
 
Domain Number 4 Region: 69-149
Classification Level Classification E-value
Superfamily PDZ domain-like 6.7e-22
Family PDZ domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000056613   Gene: ENSRNOG00000008924   Transcript: ENSRNOT00000059868
Sequence length 1416
Comment pep:known chromosome:RGSC3.4:8:45832789:46106412:-1 gene:ENSRNOG00000008924 transcript:ENSRNOT00000059868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGTQSTITDRFPLKKPIRHGSILNRESPTDKKQKVERSTSHDFDPTDSSSKKTKSSSEE
SRSEIYGLVQRCVIIQKDDNGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGT
LVTHSNHLEVVKLIRSGSYVALTVQGRPPGSPQIPLAESEVEPSVIGHMSPIMTSPHSPG
AAGNMERITSPVLMGEENNVVHNQKVEILRKMLQKEQERLQLLQEDYNRTATQRLLKEIQ
EAKKHIPQLQEQLSKATGSAQDGAVIAPSRPLGDALTLSEAETDPGDGLCRTDWSSGDAS
RPSSDSADSPKSSLKERVCLEDTPERTEGVQDAQDTQSLVGSPSTRGAPHIIGAEDDDFG
TEHEQINGQCSCFQSIELLKSRPAHLAVFLHHVVSQFDPATLLCYLYSDLYKQTNSKETR
RVFLEFHQFFLDRSAHLRVSVPEEISVDLEKRRPELIPEDLHRHYIQTMQERVHPEVQRH
LEDFRQKRSMGLTLAESELTKLDAERDKDRGTLEKERACAEQIVTKIEEVLMTAQAVEEE
RSSTMQYVILMYMKHLGVKVKEPRNLEHKRGRIGFLPKIKQSMKKDREGEEKGKRRGFPS
ILGPPRRPSRHDNSAIGRAMEIQKLRHPKHLSAPSSMSPELQDPAKLRQSGVANEGTDTG
YLPASSMSSATSGAALSQEGGRENDTGAKQVGDAVAPGDCLDSIPRVPNTVFDFPPPLLD
QVQEEECEVERVAEHGTPKPFRKFDSIAFGESQSEDEQFENDLETDPPNWQQLVSREVLL
GLKPSEIKRQEVINELFYTERAHVRTLKVLDQVFYQRVSREGILSPSELRKIFSNLEDIL
QLHVGLNEQMKAVRKRNETSVIDHIGEDLLLWFSGPGEEKLKHAAATFCSNQPFALEMIK
SRQKKDSRFQTFVQDAESNPLCRRLQLKDIIPTQMQRLTKYPLLLDNIAKYTEWPPEREK
VKKAADQCRQILNYVNQAVREAENKQRLEDYQRRLDTSSLKLSEYPNVDELRNLDLTKRK
MIHEGPLVWKVNRDKSIDLYTLLLEDILVLLQKQDDRLVLRCHSKILASTADSKHTFSPV
IKLSTVLVRQVATDNKALFVISMSDNGAQIYELVAQTVSEKTVWQDLICRMAASVKEQST
KPIPLPQPPPCEGDNDEEEPAKLKVEHHDLSVAGLQSPDRVLGLESPLISSKPQSHSMNT
PGKSEAEHLFVTATQFAKEQHANGTFKEGDGGYPVTISDPHLPVSEERWALDALRNLGLL
KQLLVQQLGLTEKTTQEDWRSFSRYRPASEEAQADSGIPDLESVKACHAGEGQMSFKTGT
GDVATCDSPRTSTESCAVQDSVILASQDSQASNIIEMDHMLLTPEVPTTAEPEGGLDDSG
EHFFDAREAHSDDNPSEGDGAVRKEEEDVNVRISGK
Download sequence
Identical sequences ENSRNOP00000056613 10116.ENSRNOP00000012043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]