SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000056753 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000056753
Domain Number 1 Region: 108-168
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.00000000000000719
Family EB1 dimerisation domain-like 0.0000834
Further Details:      
 
Domain Number 2 Region: 2-46
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000523
Family Calponin-homology domain, CH-domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000056753   Gene: ENSRNOG00000039205   Transcript: ENSRNOT00000060003
Sequence length 182
Comment pep:known chromosome:RGSC3.4:8:43844120:43846512:-1 gene:ENSRNOG00000039205 transcript:ENSRNOT00000060003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGAEKVCNVAQLMKRKFQDNFELVQWFKMFSDANYNGKEHDPVAARQGQETVVAPVAPAL
SKPKKPLSSGSAAPQRPMATQRTTAASKAGPGMVRRNPGVGNGDDEAAEWKQQVKVLTLT
VEDLEKERGFYFGKLRNIELISQESEGENDPGLQRTVDSLYATDEGFVIPDEGSPQAEQE
GC
Download sequence
Identical sequences 10116.ENSRNOP00000056753 ENSRNOP00000056753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]