SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000061188 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000061188
Domain Number 1 Region: 55-289
Classification Level Classification E-value
Superfamily L domain-like 2.95e-39
Family Ngr ectodomain-like 0.021
Further Details:      
 
Domain Number 2 Region: 586-700
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.05e-27
Family Calponin-homology domain, CH-domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000061188   Gene: ENSRNOG00000009412   Transcript: ENSRNOT00000066064
Sequence length 704
Comment pep:known chromosome:RGSC3.4:15:55643380:55788456:-1 gene:ENSRNOG00000009412 transcript:ENSRNOT00000066064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPGSEPQAFAPALSVTALHPHIHQHHQHHGSTGSAGFNLPLNRGLERALEEAANSGGL
NLSARKLKEFPRTAAPGHDLSDTVQADLSKNRLVEVPMELCHFVSLEILNLYHNCIRVIP
EAIVNLQMLTHLNLSRNQLSALPACLCGLPLKVLIASNNKLGSLPEEIGQLKQLMELDVS
CNEITALPQQIGQLKSLRELNVRRNYLKVLPPELVDLPLVKFDFSCNKVLVIPVCFREMK
QLQVLLLENNPLQSPPAQICTKGKVHIFKYLSIQACQIKTADSLYLHSIERPHSHQHVED
SKKDSDSGVGSDNGDKRLSATEPSDEDTVSLNVPMSNIAEEDQTTKEDACHRLAPAEGDF
QPTPSLLGDSGSSGQEREQFAGRADVLHCELMNYIKDQAEDCEELLRIEEDAHWQTEELL
NSSKDQDLDIVMIEQLREAEDLLQGPNGLTTDITERSILNLYPMCSAEALEFPDSSLNGQ
LQLERSPEREVQNDVTLQSNGSQCSPNEIREDSPSGSPTANITAPFGLKPRSGSWYPDEV
KGSLKAESSPRRPQLLSKHVFLRPQRNLESIDPQFTIRRKMEQMREEKELVEQLRESIEM
RLKVTLHEDLGAALMDGVVLCHLANHVRPRSVASIHVPSPAVPKLSMAKCRRNVENFLEA
CRKLGVPEEKLCLPHHILEEKGLVKVGMTVQALLDVTVTKALFT
Download sequence
Identical sequences XP_006252377.1.100692 10116.ENSRNOP00000012590 ENSRNOP00000061188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]