SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000063261 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000063261
Domain Number 1 Region: 614-869
Classification Level Classification E-value
Superfamily YWTD domain 8.63e-57
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 3-262
Classification Level Classification E-value
Superfamily YWTD domain 7.59e-55
Family YWTD domain 0.00000136
Further Details:      
 
Domain Number 3 Region: 313-552
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-50
Family YWTD domain 0.00000356
Further Details:      
 
Domain Number 4 Region: 917-1176
Classification Level Classification E-value
Superfamily YWTD domain 1.23e-39
Family YWTD domain 0.0000476
Further Details:      
 
Domain Number 5 Region: 871-918
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000067
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 569-616
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000115
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 7 Region: 1307-1345
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 8 Region: 1228-1268
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 1269-1305
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 10 Region: 265-307
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000012
Family EGF-type module 0.009
Further Details:      
 
Domain Number 11 Region: 1186-1239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000766
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000063261   Gene: ENSRNOG00000006338   Transcript: ENSRNOT00000066575
Sequence length 1595
Comment pep:known chromosome:RGSC3.4:4:171337114:171444932:-1 gene:ENSRNOG00000006338 transcript:ENSRNOT00000066575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVFGHGLIYWSDVSEEAIKRT
EFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQELD
QPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFVIINTEIYWPNGLTLDYEERKLYW
ADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDTLYWTDWNTHSILACNKYTGEGL
REIHSNIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKLLE
SGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDPVEGYVYWTD
DEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRK
ILISEDLEEPRAIVLDPMAGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLGWPNGLALD
YDEGTIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTDWQRRSIERV
HKRSAEREVIIDQLPDLMGLKATSVHRVIGSNPCAEENGGCSHLCLYRPQGLRCACPIGF
ELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYW
TDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQH
RQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGLTI
DYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDWSRRSIERA
NKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGFVCGCPA
HYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQ
LYWIDSRQNMIRKAQEDGGQGFTVVVSSVPNQNLEIQPYDLSIDIYSRYIYWTCEATNVI
DVTRLDGRSVGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFF
SGLSKPVALALDSKLSRLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLY
WIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCAQDNGGCSHIC
LVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGDIDCIPVAWRCDGFTECED
HSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEKNCEVLCLIDQFRCANGQC
VGKHKKCDHNVDCSDRSDELDCYPTEEPAPQATNTVGSVIGVIVTIFVSGTIYFICQRML
CPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSMISSLSIMGGSSGP
PYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYR
PYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSDLNYDSEPVPPPPTPRSQYL
SAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences 10116.ENSRNOP00000008486 ENSRNOP00000063261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]