SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000063876 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000063876
Domain Number 1 Region: 57-281
Classification Level Classification E-value
Superfamily L domain-like 3.74e-41
Family Ngr ectodomain-like 0.044
Further Details:      
 
Domain Number 2 Region: 639-754
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.27e-29
Family Calponin-homology domain, CH-domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000063876   Gene: ENSRNOG00000001774   Transcript: ENSRNOT00000063883
Sequence length 769
Comment pep:known chromosome:RGSC3.4:11:69595484:69692162:-1 gene:ENSRNOG00000001774 transcript:ENSRNOT00000063883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAGLVAVVAAAEYSGPVGSGGNLSGANCGPSPGLGPGSWSRSVDRALEEAAVTGVLSL
SGRKLREFPRGAANHDLTDTTRADLSRNRLSEIPMETCHFVSLESLNLYQNCIRYIPEAV
LNLQALTFLNISRNQLSTLPVHLCNLPLKVLIASNNKLVSLPEEIGQLRHLTELDVSCNE
IQTVPSQIGNLEALRDFNVRRNHLLRLPEELAEVPLIRLDFSCNKITVIPVCYRNLRHLQ
VITLDNNPLQSPPAQICIKGKIHIFKYLNIQACKIAPDLPDYERRPLGFGSCHEELYSGR
PYGALDSGFNSVDSGDKRWSGNEPTDEFSDLPLRVAEITKEQRLRRESQYQENRSSVVVT
NGGVDHDLDQIDYIDSCTTEEEENDVKRPKSLDTSSLSSQFLAYIEQRRISHEGSPVKPI
AVRDFQKTEDMKRYSHQNRVPVEPSLVLSVPPSHNQLSHSDLELHQRGEQSVERARREAQ
LAALQYEGEKIRTKQIQRDAGLDFVKHKVSQNPQKQQPPGNGECPFPSRRSQHTDDSALL
VSLSGLDGVSCVATRPHSSAFTPLKSNDRVDVTSSFPMTDTARHSPAYSFPAATQRNQPQ
RPESFLFRATVRAEASKGRASPLLSSAPATDAADSIARQREEELRLIDQLRKHIEYRLKV
SLPCDLGAALTDGVVLCHLANHVRPRSVPSIHVPSPAVPKLTMAKCRRNVENFLDACRKI
GVPQEQLCLPLHILEEKGLGQVAVTVQALLELAPPKQQPQQQPPQLSAV
Download sequence
Identical sequences 10116.ENSRNOP00000042417 ENSRNOP00000063876 XP_003752547.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]