SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Triad1|51696|fgeneshTA2_pg.C_scaffold_1000443 from Trichoplax adhaerens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Triad1|51696|fgeneshTA2_pg.C_scaffold_1000443
Domain Number - Region: 92-184
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 0.0523
Family Helical scaffold and wing domains of SecA 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Triad1|51696|fgeneshTA2_pg.C_scaffold_1000443
Sequence length 371
Sequence
MTLSRIYKNKRKLKRHSVDASLIVPNINQKASDKDQLIFTGAFQLYQSNVYAGVCGVAEL
PLPATLHILSQSFESGDTITAFHILKGNRSHTAQTLSQQQLYQAIKDTSRLSKDHSAAWR
QIWHPRLAVTSFNGIGNHRNKMAKKTIRYYLLSMYSLDGNNNNNTFHRRAFVSQLDLAWK
NSLNYTCYDAPMTMYNEKLWPYSLTNMPRLKKLFKAWRYALRKGGCDQFFNRGLPSFNLG
MLLSLIGLKFASNQLQLPMKSIIKLKDDVYLENLYYNGSYVDVNVVKGKFIEVSSFLSER
KHPLFACDASCSSIDLIGWFLSYIGFVTKFIGPPLFYLSFLSCNQIHFMRFICAYVSAFM
SRERYTEIDVW
Download sequence
Identical sequences B3RKI8
10228.JGI51696 jgi|Triad1|51696|fgeneshTA2_pg.C_scaffold_1000443 XP_002108612.1.101920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]