SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Triad1|54031|fgeneshTA2_pg.C_scaffold_3000038 from Trichoplax adhaerens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Triad1|54031|fgeneshTA2_pg.C_scaffold_3000038
Domain Number - Region: 57-131
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 0.0196
Family Helical scaffold and wing domains of SecA 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Triad1|54031|fgeneshTA2_pg.C_scaffold_3000038
Sequence length 290
Sequence
MKLSLGDEKLVSIQYDEYLQLLSLLSIRIPEEIKVEDIDAQLDIGHLANGCLLRFLRDDA
NRYNKVIRMIRKEIFQLREATNGNYSLTPRLEKICSNLRNLIVPTHWYPYLPTHLPFNQW
LEDLSRKVATLTSYIKTSQESDLNDCDLRIFYQPAGFLDSLLQDYNGLVKAGVLEIDFEV
KIFNDSEKKCDHGIHLLGLQLHNAAWDFTKCCITQVKEAQATCPLPIIWLRPIKLSNKVK
KSSYPTYSCPVLHSYYQDVDKNCMIRLSLATEIEVGILYLKRVAISVMDR
Download sequence
Identical sequences B3RQX2
XP_002110237.1.101920 jgi|Triad1|54031|fgeneshTA2_pg.C_scaffold_3000038 10228.JGI54031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]