SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Triad1|62687|fgeneshTA2_pg.C_scaffold_324000002 from Trichoplax adhaerens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triad1|62687|fgeneshTA2_pg.C_scaffold_324000002
Domain Number 1 Region: 1-183,231-243
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 3.27e-49
Family Helical scaffold and wing domains of SecA 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Triad1|62687|fgeneshTA2_pg.C_scaffold_324000002
Sequence length 255
Sequence
MNEQRKVIYEQRIQIMKEQKFDDILIDKVHIHNKYLIDKFIPDKSYKEEWQIKELIHETH
RIYNINLVINDDLSKKDIVKNLNDETSKIFKIKKDEFGEDIFNEALKRIFLLTLDQLWKE
HLHALDRLKAGINLRAYGQKDPLNEYKFEAFKLFEDMFLELDENIIITCAKIQISHELGD
IDNLDSSDNVFETKKDYNLLSDQKKSGGNVKMPNIVNNNATMDPKNPATWGKISRNELCP
CGSSKKYKYCHGSII
Download sequence
Identical sequences B3SEJ8
10228.JGI62687 XP_002118667.1.101920 jgi|Triad1|62687|fgeneshTA2_pg.C_scaffold_324000002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]