SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Triad1|62816|fgeneshTA2_pg.C_scaffold_1075000002 from Trichoplax adhaerens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triad1|62816|fgeneshTA2_pg.C_scaffold_1075000002
Domain Number 1 Region: 115-221
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 1.28e-30
Family KorB DNA-binding domain-like 0.00031
Further Details:      
 
Domain Number 2 Region: 33-124
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 4.97e-23
Family ParB-like nuclease domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Triad1|62816|fgeneshTA2_pg.C_scaffold_1075000002
Sequence length 285
Sequence
MTENEFKALGKGLSSLIPNKLDFINNQSGLTVNISIDKIIANNSQPRKSFNNEGIIELSN
SIKLYGILQPILVKKISEDNFQIIAGERRWRAAKIANLKFIPAIIKDTIDKENVEISLIE
NIQREDLNPLEEANIYKILLDEKGYTQENLAAKIGKSRSYIANLVRLLNLSEKFKKLIHE
NKLSASHARLLLNHKNPDDLIKIIQKYNLNVRETENILKNNKNPRINKKVKDAEVINLER
KIKKALNLNAKINLSDKENSIVIKFNNMDEFDYLVTLLCQNKLTI
Download sequence
Identical sequences B3SEZ1
jgi|Triad1|62816|fgeneshTA2_pg.C_scaffold_1075000002 XP_002118810.1.101920 10228.JGI62816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]