SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Triad1|25670|e_gw1.5.1430.1 from Trichoplax adhaerens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triad1|25670|e_gw1.5.1430.1
Domain Number 1 Region: 10-109
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.04e-28
Family 2Fe-2S ferredoxin-related 0.0000787
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Triad1|25670|e_gw1.5.1430.1
Sequence length 116
Sequence
MTSIFCLRVTINFVERDGEVVSVKAKLGETLLDVAKDYDISLEGACEGTLACSTCHLILK
PEIYETLPEPTDEELDMLDLAFGLSDTSRLGCQITITQEMDNMTVEVPKESYDVRQ
Download sequence
Identical sequences B3RYB5
jgi|Triad1|25670|e_gw1.5.1430.1 XP_002112461.1.101920 10228.JGI25670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]