SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Triad1|34887|e_gw1.1745.1.1 from Trichoplax adhaerens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triad1|34887|e_gw1.1745.1.1
Domain Number 1 Region: 71-116
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 2.49e-22
Family CO dehydrogenase ISP C-domain like 0.0002
Further Details:      
 
Domain Number 2 Region: 6-64
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 0.00000000000000901
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Triad1|34887|e_gw1.1745.1.1
Sequence length 120
Sequence
YIKYVVRLTGTKLVCGEGGCGACTVMVSKYDKFEQKVIHYSVNSCLIPLCTLDHAAVTTV
EGIGSTENKIHPVQERIAKAHGSQCGFCTPGFVMSMYTLLRNNSQPTEEDIEDACESTCV
Download sequence
Identical sequences B3SF54
10228.JGI34887 jgi|Triad1|34887|e_gw1.1745.1.1 XP_002118873.1.101920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]