SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Triad1|55768|fgeneshTA2_pg.C_scaffold_4000659 from Trichoplax adhaerens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triad1|55768|fgeneshTA2_pg.C_scaffold_4000659
Domain Number 1 Region: 836-1135
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.03e-88
Family Complement components 0.00000582
Further Details:      
 
Domain Number 2 Region: 1210-1332
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 6.15e-32
Family Alpha-macroglobulin receptor domain 0.00061
Further Details:      
 
Domain Number 3 Region: 674-722
Classification Level Classification E-value
Superfamily E set domains 0.000000448
Family SVA-like 0.032
Further Details:      
 
Weak hits

Sequence:  jgi|Triad1|55768|fgeneshTA2_pg.C_scaffold_4000659
Domain Number - Region: 293-360
Classification Level Classification E-value
Superfamily PA2201 C-terminal domain-like 0.00615
Family PA2201 C-terminal domain-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Triad1|55768|fgeneshTA2_pg.C_scaffold_4000659
Sequence length 1373
Sequence
MVNRFILSAFFLLILGVASVSAIDKYDNGTYIITAPAIIRPGLPTMINVNILRAPQAVTT
TAKIVSKNGTIMSQNSDTFYKGTPKSMTLQVPKNLKDDNYVLLVQSSGGLSFSQNKSIKV
STKTSSLFIQTDKAIYKPGQTSILTKDYPLADEPPLGKWTLRIVTKDDKAEKSFEIKEYV
LPRFNTKVTLPSFGLNTDDKLTISISAKYTYGMPVKGVAYIKLNPKYWYSRGSKIPEIRK
EEKIDGYLNISVPTSDIKWHLNKNKELNYFNLLVNVIVMEKLTSIKENGTSSMTYYSRPY
RVNVVSSTSAFRPGMPYHAMLAVVQPDGKAVAASLSDYLTAYYGTKSKYSWTAYHYPSMW
RSNNKEYIQLVNTSSSLKIGSTATFDVLSSKGISGVRLTFEVTSRGAIVASGSLDTTGQK
TSLSFTVTQKMAPTARVLAYYIGDNYEVIGDSYQFQVDGLFENKVSLNFDKSTEAPGKNI
KLKVKASPYSHVGVLAVDQSVLLMKTGNDLSVADVKKEIQSYGGNNYYPDYPIAFKRSVE
FKRTVMPGGGYYSSNSMKGAFKQAGLVILTDALVSGSSYPPMYMLEDGAMAPNAQAGNAN
LANKEEGGEVAQPLYVRTFFPETWLWSDKNASSSGEVVINSLMPDTITSWVASAFAVSSA
TGFGLSPTHAKVRGFQPFFVNLNLPYSVIRGEHMALQAVVFNYLSTDLVVTLVLESSSNW
QNIDLINSKIIGSGSQQYQLLVKAGQAASTYFPIMPMTIGSIPILVKASSNVASDAVVRQ
LRVEPEGIKQHYTENYMIQLSNGGRARHTFKVSLPPHLVSGSTSAKVNVIGDLMGPSISN
LDSLLQMPYGCGEQNMLGFAPDIYISKYLTATNQATSRILDKAKRYMTKGYQKELTYRRS
AGSYSAFGNRDKAGSMWLTAFVVKCFSQAKPFIYIDPKVTQPSIDWIIKKQNSDGTFQEP
GRVIHKAMKGGVTNDITLAAFVLIAMQESGVTSSSVTSAITKTQQYLEDKISTISSSYTM
AIVNYALTLTRSTAAKTAFAKLKQMAMTKDGATYWSAVKEAGKQTGRWYPPYGQSNSLNI
EATSYALMTYVLNKELAAAAPIAKWLSMQRNSMGGFSSTQDTCVALEALSRYAAMVYGSD
LNADIYIRSTNNTSFLKHFKINNANAVVLQQTDVPAGQGDIMLEANGTGIGLVQLGVQYY
VVKDPLDQSFEVEVTVLDHSTTEIIYVKSCGRWNSGGTSGMAIMEIGVPSGFSANQNKLR
EIVKSNTLSIKRYEMSGSHVVLYFDELTNNKKCVTVMMERTVPVGLLKPVPVKVFDYYEP
EKQASAFYKVSKLSTGSLCNACSSCVGCTSGSAKSSYSFVLIALITLLLANMY
Download sequence
Identical sequences B3RVT5
XP_002111588.1.101920 jgi|Triad1|55768|fgeneshTA2_pg.C_scaffold_4000659 10228.JGI55768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]