SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Triad1|55796|fgeneshTA2_pg.C_scaffold_4000687 from Trichoplax adhaerens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triad1|55796|fgeneshTA2_pg.C_scaffold_4000687
Domain Number 1 Region: 9-254
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 7.06e-34
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Triad1|55796|fgeneshTA2_pg.C_scaffold_4000687
Sequence length 280
Sequence
MGISVLSGYKVGWGYKFSYQGYVSKSVLNPHGHRYTSEIRFISKVDLEIFRHDIVKLKLN
SIRLYQDNRPSKDGKAFAKGLAAYPTYFQWIHGQITAIYTNKHEPEWVLNVKRGIISGFI
LNYIPYQTQYSISETCSSLYLHEYLDGTLGQSDIDGTCLTNYTINTEKPGLTTVTKFRDV
TNCKGRILSSSCTFDDIGRENCKDHFQVADSATFQITNNKGENGIIKRSIRREKFTFVPF
SKDKGSVVVETRRVFKYFVNYALKHDLSELYKLQGLLAKK
Download sequence
Identical sequences B3RVW0
XP_002112098.1.101920 10228.JGI55796 jgi|Triad1|55796|fgeneshTA2_pg.C_scaffold_4000687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]