SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Triad1|57885|fgeneshTA2_pg.C_scaffold_7000103 from Trichoplax adhaerens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triad1|57885|fgeneshTA2_pg.C_scaffold_7000103
Domain Number 1 Region: 2-86
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 0.000000000706
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Triad1|57885|fgeneshTA2_pg.C_scaffold_7000103
Sequence length 187
Sequence
MIENRNGISERLYFHPDDINYSTNLKRGAIELLQFNNSIIKSNPEKGVTVVEACIRGRCH
VTYYPCRVMNNCYDKINTGLRCSNRPLYPSKAYSSSKGVPQITESASGRQELSYLKDKAC
DFLLPNYFSYDESSILYQTDLETFNKFDYISYILSLKGNGELKKPSINLRELSEEYIDEE
VFENEMV
Download sequence
Identical sequences B3S1U2
XP_002114262.1.101920 10228.JGI57885 jgi|Triad1|57885|fgeneshTA2_pg.C_scaffold_7000103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]