SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|51473380|ref|YP_067137.1| from Rickettsia typhi str. Wilmington

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|51473380|ref|YP_067137.1|
Domain Number 1 Region: 121-520
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.09e-71
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.0058
Further Details:      
 
Domain Number 2 Region: 571-786
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.18e-45
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|51473380|ref|YP_067137.1|
Sequence length 933
Comment 2-oxoglutarate dehydrogenase E1 [Rickettsia typhi str. Wilmington]
Sequence
MEKYFNKTGYLFAGNAVFVEELYRQYLANPNSVDQTWQEFFADIKDNNALLNKSTAKVIR
PNPNVTKALLNNNLSYEGLHNLKAKEMISAYRRNAHYLANLDPLGLEIRKTKDELKLNIE
AFGLDSSQLEENINITDEFIGTWNCKLSELVTKLDKVYTSSIGVEFDQIENVEEKNWLYT
KLETEITFASEEKRSILNDFVEVECFEQFLHTKFPGAKRFSIEGGDSSIVAMNKAIDLSM
NQGVEEIVIGMAHRGRLNTLTKVVGKPYKAVIAGFINGNVFPDELNISGDVKYHLGYSAD
RVRANQKIHLSLADNPSHLEAINSIVAGKVRAKQDMLVDTKRSKVKAILLHGDAAFCGQG
VVAESLSMSPLTAYNVGGILHFVINNQLGFTANAADTRASRYSTEFAKIIAAPILHVNGD
DIEAVLKATDIAVEYRQKFSKDVVVEIICYRKYGHNEGDEPMYTQSKMYNIIKSKPTPGN
IYANELVKSGIIDNNYYAKLKEKFKIKLDKEYEQAKSYKQESHFLGGCWKGISRTRGKAA
ITGVNKKILQDLGTKLCEIPKDFTINPKLVRLFEVRKNTLTTDQPIDWATAEQLAFAHLL
CSGTNIRLTGQDSERGTFSHRHSILHNQIDDTTYIPLNNLSKTQAQYEVANSNLAEYAVL
GFEYGYSLASPKNLVLWEAQFGDFANGAQIIFDQFISSSATKWLRMSGLVVLLPHAFEGQ
GPEHSSARLERFLQLAAEENMYITYPTTPASIFHLLRRQILESIRKPLIVMSPKSLLRHK
YAVSKLDELGENTTFIPVLDEVTKIDKNNITKVILCSGKVYYDLFAKRVHNSNIVIIRLE
QLYPFEKTLVASLLKKYNKAQAFIWCQEEPKNMGAWNYIAEHLNDALKEAEINNEFKYVG
REESASPAVGSLQVHNKQQEKLLMEALGDDIIK
Download sequence
Identical sequences Q68XI7
WP_011190642.1.11799 WP_011190642.1.3094 WP_011190642.1.57022 257363.RT0171 gi|383752155|ref|YP_005427255.1| gi|51473380|ref|YP_067137.1| gi|383842991|ref|YP_005423494.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]