SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|51473458|ref|YP_067215.1| from Rickettsia typhi str. Wilmington

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|51473458|ref|YP_067215.1|
Domain Number 1 Region: 1-326
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.5e-101
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.000000355
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|51473458|ref|YP_067215.1|
Sequence length 326
Comment pyruvate decarboxylase [Rickettsia typhi str. Wilmington]
Sequence
MNIKPKKYKPIKEEYIKSFKDMLLLRRFEEKCGQLYGMGEIGGFCHLYIGQEAVISAVEL
IKKKGDSTITSYRDHAHIILAGTEPKYVLAELMGRATGCSKGKGGSMHLFDIPNKFYGGH
GIVGAQVPIGTGLAFAEKYNGTNNICFTFLGDGAVNQGQVYEAFNMASLWGLPVVYIIEN
NEYSMGTSVSRSTFMRDLYKKGESFGIRGFQLDGMDFEEMYNGTKQVAEYVRENSFPVIL
EVKTYRYRGHSMSDPAKYRSKEEVAKYKERDTLVRIRQIILDNKYATEEDLKAIERSVQE
VIKVAVEFSENSPLPSEDELYTDIYV
Download sequence
Identical sequences Q68XA9
WP_011190718.1.11799 WP_011190718.1.3094 WP_011190718.1.57022 gi|383843068|ref|YP_005423571.1| gi|383752232|ref|YP_005427332.1| 257363.RT0252 gi|51473458|ref|YP_067215.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]