SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|51473459|ref|YP_067216.1| from Rickettsia typhi str. Wilmington

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|51473459|ref|YP_067216.1|
Domain Number 1 Region: 3-201
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.87e-69
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.000000402
Further Details:      
 
Domain Number 2 Region: 188-322
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 8.25e-40
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0000606
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|51473459|ref|YP_067216.1|
Sequence length 326
Comment pyruvate dehydrogenase subunit beta [Rickettsia typhi str. Wilmington]
Sequence
MQITVREALRDAMQEEMLRDDKVFVIGEEVAEYQGAYKVTQGLLEQFGSKRVIDTPITEY
GFAGLAVGAAFAGLRPIVEFMTFNFAMQAFDHIVNSAAKTHYMSGGQVKCPIVFRGPNGA
ASRVAAQHSQNYTACYSHIPGLKVVAPYSAEDHKGLMLTAIRDDNPVIFLENEILYGHSF
DVPDIIEPIPFSKAKILKEGSNVTIVTFSIQVKLALDVVNILQNDNIDCELIDLRTIKPL
DTNMIIESVKKTNRLVIVEEGWFFAGVGASIASIVMKEAFDYLDAPIEIVSGKDVPLPYA
VNLEKLAMPSANDLIEAVKKVCYYTI
Download sequence
Identical sequences Q68XA8
257363.RT0253 WP_011190719.1.11799 WP_011190719.1.3094 WP_011190719.1.57022 gi|51473459|ref|YP_067216.1| gi|383843069|ref|YP_005423572.1| gi|383752233|ref|YP_005427333.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]