SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000133 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000133
Domain Number 1 Region: 433-529
Classification Level Classification E-value
Superfamily SRCR-like 1.57e-32
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00019
Further Details:      
 
Domain Number 2 Region: 3-308
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 3.53e-16
Family Soluble quinoprotein glucose dehydrogenase 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000133   Gene: ENSMMUG00000000098   Transcript: ENSMMUT00000000144
Sequence length 532
Comment pep:known_by_projection chromosome:MMUL_1:7:162915922:162936565:1 gene:ENSMMUG00000000098 transcript:ENSMMUT00000000144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFLGIAFHPRFRHNRRLYVYYSVGIRTSEWIRISEFRVSEDDENAVDHSSERWLSWGTRA
WVGAGTRMHWCDCTSWYPFLGSGPGCKATPSCALSRSARRSALLGKVLRIDVDRKERGLP
YGIPPDNPFVGDPAAQPEVYALGVRNMWRCSFDRGDPASGAGRGRLFCGDVGQNKFEEVD
LVERGGNYGWRAREGFECYDRSLCANSSLNDVLPIFAYPHTIGKSVTGGYVYRGCEYPNL
NGLYIFGDFMTGRLMSLHENPGTGQWHYSEICMGHGQTCEFPGLINNYYPYIISFGEDEA
GELYFMSTGEPSATAPRGVVYKIIDPSRRAPPGKCQIQPAQVKIRSRLIPFVPKESNQTR
VLPAGPRCPSSTPLRGNKDPVLPGLPVLQRSRKSPHPLIHHGHVPCPGDTAHGETPQSSP
SKPVSRPSGLSRPPIGRLGVFVGGRWGTVCDDSWNINGAAVVCRQLGFAYAVRAVKSAEF
GQGGSLPILLDNVRCAGWERNLLECQHNGVGTHNCEHDEDAGVVCSHQNPDL
Download sequence
Identical sequences ENSMMUP00000000133 9544.ENSMMUP00000000133 ENSMMUP00000000133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]