SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000159 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000159
Domain Number 1 Region: 1-99
Classification Level Classification E-value
Superfamily Immunoglobulin 4.59e-45
Family V set domains (antibody variable domain-like) 0.0000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000159   Gene: ENSMMUG00000000120   Transcript: ENSMMUT00000000171
Sequence length 100
Comment pep:known_by_projection scaffold:MMUL_1:1099214757507:238:537:1 gene:ENSMMUG00000000120 transcript:ENSMMUT00000000171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFSNYYMHWVRQAQGKGLEWVGLIRNKANSYTT
EYAAAVKGRFTISRDDSKNTLYLQMSSLKTEDTALYYCTK
Download sequence
Identical sequences ENSMMUP00000000159 ENSMMUP00000000159 9544.ENSMMUP00000000159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]