SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000244 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000244
Domain Number 1 Region: 101-315
Classification Level Classification E-value
Superfamily FKBP-like 9.23e-31
Family FKBP immunophilin/proline isomerase 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000244   Gene: ENSMMUG00000000173   Transcript: ENSMMUT00000000257
Sequence length 1246
Comment pep:known_by_projection chromosome:MMUL_1:15:22893077:22948619:1 gene:ENSMMUG00000000173 transcript:ENSMMUT00000000257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVGGDKPWDSGNTQLPPRSLVKANAMFGAGDEDDTDFLSPSGGARLASLFGLDQAAAGHG
NEFFQYTAPKQPKKGQGTAATGHQATPKTAPATMSTPAILVATAVHAYRYTNGQYVKQGK
FGAAVLGNHTAREYRILLYISQQQPVTVARIHVNFELMVRPNNYSTFYDDQRQNWSIMFE
SEKAAVEFNKQVCIAKCNSTSSLDAVLSQDLIVAEGPAVEVGDSLEVAYTGWLFQNHVLG
QVFDSTANKDKLLRLKLGSGKVIKGWEDGMLGMKKGGKRLLIVPPACAVGSEGVIGWTQA
TDSILVFEVEVRRVKFARDSGSDGHSVSSRDSAAPSPIPGADNLSADPVVSPPTSIPFKS
GEPALRTKSNSLSEQLAINTSPDAVKAKLISRMAKMGQPMLPILPPQLDSNDSEIEDVNA
LRGGGQPVVTPSVQPSLQPAHPVLPQDISLAPQASVSGLQAPSTALMQVASLDSHSAVSG
NAQSFQPYAGMQAYAYPQASAVTSQLQPVRPLYPAPLSQPPHFQGSGDMASFLMTEARQH
NTEIRMAVSKVADKMDHLMTKVEELQKHSAGNSMLIPSMSVTMETSMIMSNIQRIIQENE
RLKQEILEKSNRIEEQNDKISELIERNQRYVEQSNLMMEKRNNSLQTATENTQARVLHAE
QEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQMQLTESLKETDLLRGQLTKVQAKLS
ELQETSEQAQSKFKSEKQSRKQLELKVTSLEEELTDLRAEKESLEKNLSERKKKSAQERS
QAEEEIDEIRKSYQEELDKLRQLLKKTRVSTDQAAAEQLSLVQAELQTQWEAKCEHLLAS
AKDEHLQQYQEVCAQRDAYQQKLVQLQEKCLALQAQITALTKQNEQHVKELEKNKSQMSG
VEAAASDPSEKVKKIMNQVFQSLRREFELEESYNGRTILGTIMNTIKMVTLQLLNQQEQE
KEESSSSEEEEEKAEEQPRRPSQEQSASASSGQPQAPLNRERPESPVVPSEQVVEEAVPL
PPQALTTSEDDVHRRKGDSEAEALSEIKDGSLPPELSCIPSHRVLGPPTSIPPEPPGPGT
MDSECEESLAPSPVAAKPNNPPGKVCVREVAPDGPLQESSTRPSLTSDPEKGDPLALGPE
SPGEPQPPQLKKDDVTSSTGPHEELLSTEAGSTVAGAALRSSHHSQHSSLSRDEEDALSK
GAALKALRPKAQPEEEDEDEVSMKGRPPPTPLFGDDDDDDDIDWLG
Download sequence
Identical sequences ENSMMUP00000000244 ENSMMUP00000000244 9544.ENSMMUP00000000244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]