SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000282 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000282
Domain Number 1 Region: 13-226
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.92e-33
Family Voltage-gated potassium channels 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000000282
Domain Number - Region: 239-402
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.000689
Family Potassium channel NAD-binding domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000282   Gene: ENSMMUG00000000200   Transcript: ENSMMUT00000000298
Sequence length 1078
Comment pep:known_by_projection chromosome:MMUL_1:8:37219661:37361488:1 gene:ENSMMUG00000000200 transcript:ENSMMUT00000000298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
INGCTCTGTFQVILVFVLSIGSLIIYFINSADPVGSCSSYEDKTIPVDLVFNAFFSFYFG
LRFMAADDKIKFWLEMNSIVDIFTIPPTFISYYLKSNWLGLRFLRALRLLELPRILQILR
AIKTSNSVKFSKLLSIVLSTWFTAAGFIHLVENSGDPWLKGRNSQNISYFDSVYLVMATT
STVGFGDVVAKTSLGRTFIIFFTLGSLILFANYIPEMVELFANKRKYTSSYEALKGKKFI
VVCGNITVDSVTAFLRNFLRRKSGEINTEIVFLGESPPSLELETIFKCYLAYTTFISGSA
MKWEDLRRVAVESAEACLIIANPLCSDSHAEDISNIMRVLSIKNYDSTTRIIIQILQSHN
KVYLPKIPSWDWDAGDNIICFAELKLGFIAQGCLVPGLCTFLTSLFVEQNRKVTPKQTWQ
KHFLNSMKNNILTQRLSDDFAGMSFPEVARLCFLKMHLLLIAIEYKSLFTDGFCGLILNP
PAQIRIHKNTLGFFIAETPKEVKRALFYCSVCHDDVFIPELITNCGCKSRSRQHVTEKER
FACCFQNGRKDRNCSEFCGAVLINIDNSQKNFPLTNATEYLCEEIFKTLKAEATSLIEPI
CKAAFKGKQNAPLTERGRLSRHDISIVPGEMKIDNKYLNCQKLDSSGMFHWCKPISLDKV
TLKRSRKLKHKFRNHIVACVFGDAQSALIGLRNFVMPLRASNYTRKELKDIVFIGSLDYL
QREWRFLRNFPQIYILPGCALYSGDLHAANIEQCSMCVVLSPPSKPSSSQTLVDAEAILA
TLTIGSLQIDSSSDSSPSVSGSVRMPGLLDISMGNFRVHETEETASCTNGHNEKSNCRKV
PILIELKNPSNIHFIEQLGGLEGSLQETNLHLSTAFSTGTVFSGSFLDSLLATAFYNYHV
LELLQMLVTGGVSSQLEQHLDKDKVYGVADSCTTLLSGRNRCKMGLLSLHQTILSDVNPR
NTFGQLFCGSLDLFGILCVGLYRIIDEEELNPENKRFVITRPANEFKLLPSDLVFCAIPF
STACYKRNEEFSSQKSFYSYPSRTNSVYSANQTARNQVTMQKKMERKSQMRFLMRTPL
Download sequence
Identical sequences ENSMMUP00000000282 9544.ENSMMUP00000000282 ENSMMUP00000032148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]