SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000293 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000293
Domain Number 1 Region: 36-136
Classification Level Classification E-value
Superfamily Immunoglobulin 3.68e-17
Family I set domains 0.016
Further Details:      
 
Domain Number 2 Region: 178-231
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000335
Family EGF-type module 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000293   Gene: ENSMMUG00000000208   Transcript: ENSMMUT00000000310
Sequence length 645
Comment pep:known_by_projection chromosome:MMUL_1:8:32832548:33051196:1 gene:ENSMMUG00000000208 transcript:ENSMMUT00000000310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSERKEGRGKGKGKKKERGSGKKPKSAAGSHSPALPPRLKEMKSQESAAGSKLVLRCETS
SEYSSLRFKWFKNGNELNRKNKPQNIKIQKKPGKSELRISKASLADSGEYMCKVISKLGN
DSASANITIVDSNEIITGMPASTEGAYMSSESPIRISVSTEGANTSSSTSTSTTGTSHLV
KCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEA
EELYQKRVLTITGICIALLVVGIMCVVAYCKTKKQRKKLHDRLRQSLRSERNNMMNIANG
PHHPNPPPENVQLVNQYVSKNVISSEHIVEREAETSFSTSHYTSTAHHSTTVTQTPSHSW
SNGHTESILSESHSVIMMSSVENSRHSSPTGGPRGRLNGTGGPRECNSFLRHARETPDSY
RDSPHSERYVSAMTTPARMSPVDFHTPSSPKSPPSEMSPPVSSMTVSMPSMAVSPFVEEE
RPLLLVTPPRLREKKFDHHPQQFSSFHHNPAHDSNSLPPSPLRIVEDEEYETTQEYEPAQ
EPVKKLANSRRAKRTKPNGHIANRLEVDGNTSSQSSNSESETEDERVGEDTPFLGIQNPL
AASLEATPAFRLADSRTNPAGRFSTQEEIQARLSSVIANQDPIAV
Download sequence
Identical sequences XP_015000627.1.72884 ENSMMUP00000000293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]