SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000294 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000294
Domain Number 1 Region: 36-136
Classification Level Classification E-value
Superfamily Immunoglobulin 6.37e-18
Family I set domains 0.014
Further Details:      
 
Domain Number 2 Region: 178-229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000791
Family EGF-type module 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000294   Gene: ENSMMUG00000000208   Transcript: ENSMMUT00000000311
Sequence length 247
Comment pep:known_by_projection chromosome:MMUL_1:8:32833039:33029950:1 gene:ENSMMUG00000000208 transcript:ENSMMUT00000000311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSERKEGRGKGKGKKKERGSGKKPKSAAGSHSPALPPRLKEMKSQESAAGSKLVLRCETS
SEYSSLRFKWFKNGNELNRKNKPQNIKIQKKPGKSELRISKASLADSGEYMCKVISKLGN
DSASANITIVDSNEIITGMPASTEGAYMSSESPIRISVSTEGANTSSSTSTSTTGTSHLV
KCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCQPGFTGARCTENVPMKVQNQESAQMSLL
VIAAKTT
Download sequence
Identical sequences ENSMMUP00000000294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]