SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000303 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000303
Domain Number 1 Region: 239-339
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.72e-24
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0000594
Further Details:      
 
Domain Number 2 Region: 91-143
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000419
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.047
Further Details:      
 
Domain Number 3 Region: 12-68
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000055
Family HLH, helix-loop-helix DNA-binding domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000303   Gene: ENSMMUG00000000215   Transcript: ENSMMUT00000000321
Sequence length 667
Comment pep:known_by_projection chromosome:MMUL_1:19:52658537:52698193:1 gene:ENSMMUG00000000215 transcript:ENSMMUT00000000321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDWQDHRSTTELRKEKSRDAARSRRSQETEVLYQLAHTLPFARGVSAHLDKASIMRLTIS
YLRMHRLCTAGEWNQVGAGGEPLDACYLKALEGFVMVLTTEGDMAYLSENVSKHLGLSQL
ELIGHSIFDFIHPCDQEELQDALTPQQNLSRRKVEAPTERCFSLRMKSTLTSRGRTLNLK
AATWKVLHCSGHMRAYKPPAQTSPAGSPDSEPPLQCLVLICEAIPHPGSLEPPLGRGAFL
SRHSLDMKFTYCDDRIAEVAGYSPDDLIGCSAYEYIHALDSDAVSKSIHTLLSKGQAVTG
QYRFLARNGGYLWTQTQATVVSGGRGPQSESIVCVHFLISRVEETGVVLSLEQTEQHSRR
PIQRGAPSQKDTPNPGNSLDAPGSRILAFLHPPSLSEAALAADPRRFCSPDLRRLLGPIL
DGASVAATPSTPLATRHPRSPLSADLPDELPVGTENVHRLFTSGKDTEAVETDLDIAQDA
DALDLEMLAPYISMDDDFQLNASEQLPRAYHRPLGAVPRPRAQSFHGLSPPALEPSLLPR
WGSDPRLSCSNPSRGNPSASSSMAGARKRTLAQSAEDEDEGVELLGVRPPKRSPSPEPEN
FLLFPLSLSFLLTGGPAPGRLQDPSTHLLDLNEPLGLGPSLLSPYSDEDTTQPRDHFQPT
AGSAQAD
Download sequence
Identical sequences ENSMMUP00000000303 XP_002801349.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]