SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000304 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000304
Domain Number 1 Region: 185-285
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.07e-24
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0000594
Further Details:      
 
Domain Number 2 Region: 37-89
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000038
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000304   Gene: ENSMMUG00000000215   Transcript: ENSMMUT00000000322
Sequence length 630
Comment pep:known_by_projection chromosome:MMUL_1:19:52651897:52701471:1 gene:ENSMMUG00000000215 transcript:ENSMMUT00000000322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLTISYLRMHRLCTAGEWNQVGAGGEPLDACYLKALEGFVMVLTTEGDMAYLSENVSKH
LGLSQLELIGHSIFDFIHPCDQEELQDALTPQQNLSRRKVEAPTERCFSLRMKSTLTSRG
RTLNLKAATWKVLHCSGHMRAYKPPAQTSPAGSPDSEPPLQCLVLICEAIPHPGSLEPPL
GRGAFLSRHSLDMKFTYCDDRIAEVAGYSPDDLIGCSAYEYIHALDSDAVSKSIHTLLSK
GQAVTGQYRFLARNGGYLWTQTQATVVSGGRGPQSESIVCVHFLISRVEETGVVLSLEQT
EQHSRRPIQRGAPSQKDTPNPGNSLDAPGSRILAFLHPPSLSEAALAADPRRFCSPDLRR
LLGPILDGASVAATPSTPLATRHPRSPLSADLPDELPVGTENVHRLFTSGKDTEAVETDL
DIAQDADALDLEMLAPYISMDDDFQLNASEQLPRAYHRPLGAVPRPRAQSFHGLSPPALE
PSLLPRWGSDPRLSCSNPSRGNPSASSSMAGARKRTLAQSAEDEDEGVELLGVRPPKRSP
SPEPENFLLFPLSLSFLLTGGPAPGRLQDPSTHLLDLNEPLVLSLPILDPYPLGCAAPGL
HASPFSLPTISVPQNCLHFPPQPSRHALTL
Download sequence
Identical sequences ENSMMUP00000000304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]