SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000333 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000333
Domain Number 1 Region: 179-241
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.28e-21
Family Complement control module/SCR domain 0.004
Further Details:      
 
Domain Number 2 Region: 85-142
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000852
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 3 Region: 23-87
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000848
Family Complement control module/SCR domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000333   Gene: ENSMMUG00000000241   Transcript: ENSMMUT00000000356
Sequence length 243
Comment pep:novel chromosome:MMUL_1:1:173579900:173601254:-1 gene:ENSMMUG00000000241 transcript:ENSMMUT00000000356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLMISVILISQISSVGGEATFCDFPKIKHGILYDEEKHKPFSQVPTGEVFYYSCEYNFV
SPSKSFWTRITCTEEGWSPTPKCLRLCFFPFVENGHSESSGQTHLEGDTVQIICNTGYSL
QNKENNISCVERGWSAPPKCRSTSNSNSFWSKLLNKSQGGSKLSLIFLSSSEPPKLHDPC
VISQEMMEKYNIKLKWTNQRKLYSRTGDIVEFDCKYGYRPTKSHSFRAVCQDGKLIYPSC
EEK
Download sequence
Identical sequences ENSMMUP00000000333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]