SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000335 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000335
Domain Number 1 Region: 272-337
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.59e-20
Family Complement control module/SCR domain 0.0054
Further Details:      
 
Domain Number 2 Region: 153-210
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000148
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 3 Region: 215-274
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000236
Family Complement control module/SCR domain 0.00093
Further Details:      
 
Domain Number 4 Region: 90-147
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000157
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 5 Region: 28-93
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000121
Family Complement control module/SCR domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000335   Gene: ENSMMUG00000000243   Transcript: ENSMMUT00000000358
Sequence length 343
Comment pep:novel chromosome:MMUL_1:1:173533867:173601363:-1 gene:ENSMMUG00000000243 transcript:ENSMMUT00000000358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGLPSMLLLFSVILISWVSTVGGEATLCDFPKIRHGFLYDEENYKPFSQVPIGEVFYYSC
EYNFVSPSKSFWTRITCTEEGWSPTPKCLRMCSFPFVKNGHSESSGQIHLEGDTVQIVCN
AGYSLQNKEKSISCVERGWSAPPKCSFTRRVQSCGPPPQLSNGEVKEIRKEEYRHNEVVE
YYCNRNFIIKGPKKIQCVDGKWTTLPTCVESTAYCGPPPSINNGDITSFPLSVYPPWSTV
TYRCQSFYELQGSVTVTCRNKQWSEPPRCLDPCVISEENMNKNNIQLRWRNNEKVYVKTG
DAVEFQCKFLYKAKISSPSFRAICQEGKFEYPICERSELNFPE
Download sequence
Identical sequences ENSMMUP00000000335 9544.ENSMMUP00000000335 ENSMMUP00000000335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]