SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000336 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000336
Domain Number 1 Region: 581-660
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.1e-21
Family Complement control module/SCR domain 0.0058
Further Details:      
 
Domain Number 2 Region: 453-532
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.77e-20
Family Complement control module/SCR domain 0.0044
Further Details:      
 
Domain Number 3 Region: 206-268
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000283
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 4 Region: 333-389
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000275
Family Complement control module/SCR domain 0.00076
Further Details:      
 
Domain Number 5 Region: 396-455
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000341
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 6 Region: 273-327
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000513
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 7 Region: 522-578
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000017
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 8 Region: 154-214
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000721
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 9 Region: 89-148
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000354
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 10 Region: 25-95
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000341
Family Complement control module/SCR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000336   Gene: ENSMMUG00000000244   Transcript: ENSMMUT00000000359
Sequence length 661
Comment pep:known_by_projection chromosome:MMUL_1:1:173482182:173514789:1 gene:ENSMMUG00000000244 transcript:ENSMMUT00000000359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLKNLTFIIILIISGELYAEEKPCGFPHVENGRIAQYYYIFKSYYFPMSIDQKLSFFCL
AGYTTESGRQEERTTCTTEGWSPEPRCFKKCTKPDLSNGYISDVKLLYKIQENMHYGCAS
GYKTTGGKDEEVVQCLSDGWSSQPTCRKEHETCLAPELYNGNYSTTQKTFKVKDKVQYEC
ATGYYTAGGKKTEEVECLTYGWSLTPKCTKLKCSSLRLIENGYFHPVKQTYEEGDVIQFF
CHENYYLSGSDLIQCYNFGWYPESPVCEGRRNRCPPPPLPINSKIQTHSTTYRHGEIVRI
ECELNFVIHGSEEIRCENGKWTEPPKCIEGQERVACEEPPFVENGAANLHSKIYYNGDKV
TYACKSGYLLRGSNEITCNRGTWTLAPECVENNENCKHPPVVMNGAVADGLLASYAAGSS
VEYRCNEYYLLKGSKISRCEQGKWSSPPVCLEPCTVNVDYMNRNNIEMKWKYEGKVLHGD
LIDFVCKQGYDLSPLTPLSELSVQCNRGEVKYPLCTRKESKGMCTSPPLIKHGDIISSVV
DTYENGSSVEYRCFDHHFLQGSREAYCLEGTWTTPPLCLEPCTLSFTEMEKNNLLLKWDF
DNRPHILHGEYVEFICRGDTYPAELYITGSILRMQCDRGQLKYPRCIPRQRTLSYQEPLR
T
Download sequence
Identical sequences A0A2K5TS80 F6XAB8
XP_001111017.1.72884 XP_005540363.1.63531 9544.ENSMMUP00000000336 ENSMMUP00000000336 ENSMMUP00000000336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]