SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000355 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000355
Domain Number 1 Region: 21-138
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 4.3e-26
Family Rhodopsin-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000355   Gene: ENSMMUG00000000261   Transcript: ENSMMUT00000000382
Sequence length 139
Comment pep:known_by_projection chromosome:MMUL_1:10:67844649:67853660:1 gene:ENSMMUG00000000261 transcript:ENSMMUT00000000382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRELAQPASVLSLPVCGPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNY
FVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRY
IAIRIPLRYNGLVTGTRAK
Download sequence
Identical sequences ENSMMUP00000000355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]