SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000361 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000361
Domain Number 1 Region: 151-273
Classification Level Classification E-value
Superfamily C-type lectin-like 4.2e-33
Family C-type lectin domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000361   Gene: ENSMMUG00000000266   Transcript: ENSMMUT00000000388
Sequence length 277
Comment pep:known_by_projection chromosome:MMUL_1:8:121588809:121627500:1 gene:ENSMMUG00000000266 transcript:ENSMMUT00000000388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGLASLLRRNQFILLVLFLLQIQSLGLDIDSRPTAEVCATHTISPGPKGDDGEKGDPGE
EGKHGKVGRMGPKGIKGELGDIGDQGNIGKTGPIGKKGDKGEKGLLGIPGEKGKAGTVCD
CGRYRKFVGQLDISIARLKTSMKFVKNVIAGIRETEEKFYYIVQEEKNYRESLTHCRIRG
GMLAMPKDEAANTLIADYVAKSGFFRVFIGVNDLEREGQYVFTDNTPLQNYSNWNEGEPS
DPYGHEDCVEMLSSGRWNDTECHLTMYFVCEFIKKKK
Download sequence
Identical sequences A0A2K5KZZ2 A0A2K5Z9C8 A0A2K6CPN3 G7PCQ2
ENSMMUP00000000361 9544.ENSMMUP00000000361 XP_011717068.1.29376 XP_011828381.1.47321 XP_011912798.1.92194 ENSMMUP00000000361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]