SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000568 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000568
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 1.44e-33
Family Ribosomal L11/L12e N-terminal domain 0.00000649
Further Details:      
 
Domain Number 2 Region: 75-148
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 1.15e-18
Family Ribosomal protein L11, C-terminal domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000568   Gene: ENSMMUG00000000422   Transcript: ENSMMUT00000000617
Sequence length 165
Comment pep:known chromosome:MMUL_1:15:99129420:99133125:1 gene:ENSMMUG00000000422 transcript:ENSMMUT00000000617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITV
KLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIINIARQMRHRS
LARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAVECPAS
Download sequence
Identical sequences A0A096P207 A0A0D9SB72 A0A2K5JHX6 A0A2K5P3A6 A0A2K5Y3G6 A0A2K6CIU8 A0A2K6KZU6 A0A2K6RBE9 F7AD35 G8F4M8
NP_001180489.1.72884 XP_005582230.1.63531 XP_005590212.1.63531 XP_007972902.1.81039 XP_008000069.1.81039 XP_008004357.1.81039 XP_010366146.1.97406 XP_011709724.1.29376 XP_011786744.1.43180 XP_011843787.1.47321 XP_011894492.1.92194 XP_011895602.1.92194 XP_011929319.1.92194 XP_017735496.1.44346 XP_017748323.1.44346 ENSMMUP00000000568 9544.ENSMMUP00000000568 ENSMMUP00000000568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]