SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000570 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000570
Domain Number 1 Region: 42-115
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 6.41e-19
Family Ribosomal protein L11, C-terminal domain 0.0044
Further Details:      
 
Domain Number 2 Region: 1-53
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 0.000000000000438
Family Ribosomal L11/L12e N-terminal domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000570   Gene: ENSMMUG00000000422   Transcript: ENSMMUT00000000619
Sequence length 132
Comment pep:known chromosome:MMUL_1:15:99129458:99133122:1 gene:ENSMMUG00000000422 transcript:ENSMMUT00000000619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLIEVVPSASALIIKALKEPPRDRK
KQKNIKHSGNITFDEIINIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGRHPHDIID
DINSGAVECPAS
Download sequence
Identical sequences A0A2I3MAD2 A0A2K5JHZ5 A0A2K5P3F3 A0A2K5UBV6 A0A2K5Y3H7 A0A2K6CIU6 A0A2K6KZT5 A0A2K6RBF0 F7ACP6
ENSMMUP00000000570 XP_011786746.1.43180 XP_011843796.1.47321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]