SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000732 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000732
Domain Number 1 Region: 357-438
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.05e-18
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0067
Further Details:      
 
Domain Number 2 Region: 150-204,231-246,274-292
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.82e-16
Family BphP N-terminal domain-like 0.051
Further Details:      
 
Domain Number 3 Region: 68-151
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000249
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Domain Number 4 Region: 544-708
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 0.00000000129
Family Tetraviridae-like VP 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000732   Gene: ENSMMUG00000000541   Transcript: ENSMMUT00000000790
Sequence length 763
Comment pep:known_by_projection chromosome:MMUL_1:1:129215486:129262560:-1 gene:ENSMMUG00000000541 transcript:ENSMMUT00000000790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EMTSDVPSLGPAIASGNPGPGIQGGGAIVQRAVKRRPGLDFDDDGEGNSKFLRCDDDQMS
NDKERFARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVSHMKSLR
GTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVLNQPQSE
WFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLKTGTVKKEGQQSSMRMCMGSRRSF
ICRMRCGSSSVDPVSVNRLSFVRNRCRNGLGSVKDGEPHFVVVHCTGYIKAWPPAGVSLP
DDDPEAGQGSKFCLVAIGRLQAKVTSSPHCTDMSNVCQPTDEPRSRHCTPAWATRAKLHL
KKKELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTF
QNPYSDEIEYIICTNTNVKNSSQEPRPTLSNTIQRPQLGPTANLPLEMGSGQLAPRQQQQ
QTELDMVPGRDGLASYNHSQVIQPVTTTGPEHSKPLEKSDGLFAQDRDPRFSEIYHNINA
DQSKGISSSTVPATQQLFSQGNTFPPTPRPAENFRNSGLAPPVTIVQPSASAGQILAQIS
RHSNPTQGATPAWTPTTRSGFSAQQVATQATAKTRTSQFGVGNFQTPPSFSSISLPGAPT
ASPGAAAYPSLTSRGSNFAPETGQTAGQFQTRTAEGVGVWPQWQGQQPHHRSSSSEQHVQ
QPSAQQPGQPEVFQEMLSMLGDQSNSYNNEEFPDLTMFPPFSE
Download sequence
Identical sequences ENSMMUP00000000732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]