SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000734 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000734
Domain Number 1 Region: 272-374
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.8e-28
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0029
Further Details:      
 
Domain Number 2 Region: 1-84
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000379
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Domain Number 3 Region: 83-137,164-179,207-220
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000102
Family BphP N-terminal domain-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000734   Gene: ENSMMUG00000011566   Transcript: ENSMMUT00000000792
Sequence length 591
Comment pep:known_by_projection chromosome:MMUL_1:7:59627244:59745881:1 gene:ENSMMUG00000011566 transcript:ENSMMUT00000000792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RENHSEIERRRRNKMTQYITELSDMVPTCSALARKPDKLTILRMAVSHMKSMRGTGNKST
DGAYKPSFLTEQELKHLILEAADGFLFVVAAETGRVIYVSDSVTPVLNQPQSEWFGSTLY
EQVHPDDVEKLREQLCTSENSMTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCG
NAPLDHLPLNRITTMRKRFRNGLGPVKEGEAQYAVVHCTGYIKAWPPAGMTIPEEDADVG
QGSKYCLVAIGRLQVTSSPVCMDMNGMSVPTEFLSRHNSDGIITFVDPRCISVIGYQPQD
LLGKDILEFCHPEDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWMLIRTSSFTFQNPY
SDEIEYIICTNTNVKQLQQQQAELEVHQRDGLSSYDLSQVPVPNLPAGVHEAGKSVEKAD
VFFSPDKEEKVQRIFSISSLAEKKMMSSASAAGTQQIYSQGSPFPSGHSGKAFSSSVVHV
PGVNDIQSSSSTGQNMSQISRQLNQSQVAWTGSRPPFPGQQIPSQSSKTQSSPFGIGTSH
TYPADPSSYSPLSSPATSSPSGNAYSSLANRTPGFGDLRIKQELDVPADVP
Download sequence
Identical sequences ENSMMUP00000000734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]