SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000748 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000748
Domain Number 1 Region: 164-270
Classification Level Classification E-value
Superfamily C-type lectin-like 1.88e-37
Family Link domain 0.0032
Further Details:      
 
Domain Number 2 Region: 275-360
Classification Level Classification E-value
Superfamily C-type lectin-like 2.53e-30
Family Link domain 0.0011
Further Details:      
 
Domain Number 3 Region: 49-164
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000304
Family V set domains (antibody variable domain-like) 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000748   Gene: ENSMMUG00000000556   Transcript: ENSMMUT00000000808
Sequence length 360
Comment pep:known_by_projection chromosome:MMUL_1:7:68487885:68511057:-1 gene:ENSMMUG00000000556 transcript:ENSMMUT00000000808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLLLLVPLLLLPGSYGLPFYNGFYYSNSANDQNPGNGHGKDLLNGVKLVVETPEETLFT
YQGASVILPCRYHYEPALGSPRRVRIKWWKLSENGAPEKDVLVAIGVRHRSFGDYQGRVH
LRQEKEHDVSLEIQDLRLEDYGRYRCEVIDGLEDESGLVELELRGVVFPYQSPNGRYQLN
FHEGQQVCAEQGAVVASFEQLFRAWEEGLDWCNAGWLQDATVQYPIMLPRQPCGGPGLAP
GVRSYGPRHRRRHRYDVFCFATALKGRVYYLEHPEKLTLTEAKEACQEDDATIAKVGQLF
AAWKFHGLDRCDAGWLADGSVRYPVVHPHPNCGPPEPGVRSFGFPDPQSHLYGVYCYRQH
Download sequence
Identical sequences F6ZXE2 G7P9E1
ENSMMUP00000000748 ENSMMUP00000000749 ENSMMUP00000000748 XP_001090704.1.72884 9544.ENSMMUP00000000749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]