SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000782 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000782
Domain Number 1 Region: 1028-1183,1221-1300
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.02e-42
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Domain Number 2 Region: 1350-1547,1574-1599
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.66e-38
Family Voltage-gated potassium channels 0.021
Further Details:      
 
Domain Number 3 Region: 576-723,757-804
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.69e-30
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Domain Number 4 Region: 134-275,383-452
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.85e-28
Family Voltage-gated potassium channels 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000782   Gene: ENSMMUG00000000580   Transcript: ENSMMUT00000000843
Sequence length 1833
Comment pep:novel chromosome:MMUL_1:16:59496077:59528462:-1 gene:ENSMMUG00000000580 transcript:ENSMMUT00000000843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARPSLCTLVPLGPDCLRPFTRESLAAIEQRAVEEEARLQRNKQMEIEEPERKPRSDLEA
GKNLPMIYGDPPPEVIGIPLEDLDPYYSDKKTFIVLNKGKAIFRFSATPALYLLSPFSLV
RRGAIKGFGMGKMGMFIMITILTNCVFMTMSDPPPWSKNVEYTFTGIYTFESLIKILARG
FCVDDFTFLRDPWNWLDFSVIMMAYLTEFVDLGNISALRTFRVLRALKTITVIPGLKTIV
GALIQSVKKLSDVMILTVFCLSVFALVGLQLFMGNLRQKCVRWPPPFNDTNTTWYSNDTW
YGNDTWYGNEMWYGNDSWYANDTWNSHASWATQLFDWDYINDEGNFYFLEGSSDALLCGN
SSDAGHCPEGYECIKTGRNPNYGYTSYDTFSWAFLALFRLMTQDYWENLFQLTLRAAGKT
YMIFFVVIIFLGSFYLINLILAVVAMAYAEQNEATLAEDKEKEEEFQQMLEKFKKHQEEL
EKAKAAQALEGGEADGDPAHGKDCNGSLDASPGQKGAPRQSGSGDSSISDAMEELEEAHQ
KCPPWWYKCAHKVLIWDCCAPWMKFKNIIHLIVMDPFVDLGITICIVLNTLFMAMEHYPM
TEHFDHVLTVGNLVFTGIFTAEMDLKLIAMDPYEYFQQGWNIFDSIIVTLSLVELGLANV
QGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLF
GKSYKDCVCKIALDCSLPRWHMYDFFHSFLIVFRILCGEWIETMWDCMEVAGQAMCLTVF
LMVMVIGNLVVLNLFLALLLSSFSADSLAASDEDGEMNNLQIAIGRIKLGISFAKAFLLG
LLHGKILSPKDIMLSLGEPVGAGEAGEAGETAPVDEKKEPPEEDLKKDSHILNHMSLADD
PPSSIELDHLNFINNPYLTIQVPIASEESDLEMPTEEETDTFSEPEDSKKPPQPLYDGNS
SVCSTADYKPPEEDPEEQAEENPEGEQPEECFTEACVQRWPCLYVDISQGRGKKWWTLRR
ACFKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRRVIRTILEYADKVFTYIFIMEMLL
KWVAYGFKVYFTNAWCWLDFLIVDVSIISLVANWLGYSELGPIKSLRTLRALRPLRALSR
FEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYYCINTTTSERFDISE
VNNKSECESLMHTGQVRWLNVKVNYDNVGLGYLSLLQVATFKGWMDIMYAAVDSREKEEQ
PQYEVNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKMRKDIFMTEEQKKYYNAM
KKLGSKKPQKPIPRPQNKIQGMVYDLVTKQAFDITIMILICLNMVTMMVETDDQSQLKVD
ILYNINMIFIIIFTGECVLKMLALRQYYFTVGWNIFDFVVVILSIVGLALSDLIQKYFVS
PTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMSN
FAYVKKESGIDDMFNFETFGNSIICLFEITTSAGWDGLLNPILNSGPPDCDPNLENPGTS
VKGDCGNPSIGICFFCSYIIISFLIVVNMYIAIILENFNVATEESSEPLGEDDFEMFYET
WEKFDPDATQFIAYSRLSDFVDTLQEPLRIAKPNKIKLITLDLPMVPGDKIHCLDILFAL
TKEVLGDSGEMDALKQTMEEKFMAANPSKVSYEPITTTLKRKHEEVCAIKIQRAYRRHLL
QRSVKQASYMYRHSHDGSGDNAPEKEGLLANTMSKMYGHENGNSSSQSPEEKGEAGDAIP
TMGLMPISPSDTAQPPTSPPGHIVRPGVKESLV
Download sequence
Identical sequences ENSMMUP00000000782 ENSMMUP00000000782 9544.ENSMMUP00000000782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]