SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000905 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000905
Domain Number 1 Region: 138-401
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.13e-54
Family Eukaryotic proteases 0.00019
Further Details:      
 
Domain Number 2 Region: 32-94
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000297
Family Complement control module/SCR domain 0.002
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000000905
Domain Number - Region: 107-154
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00748
Family Complement control module/SCR domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000905   Gene: ENSMMUG00000000672   Transcript: ENSMMUT00000000967
Sequence length 402
Comment pep:known chromosome:MMUL_1:20:70561392:70581872:-1 gene:ENSMMUG00000000672 transcript:ENSMMUT00000000967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SALGAVVALLLWGQLFAVDSGNDVTDIADDGCPKPPMIANGYVEHSVRYQCKNYYRLRTE
GDGVYTLNNEKQWTNKAVGDKLPECEAVCGKPKNPADAYVMLPVADQYNCIKHYEGSTPG
RGQMYTLNNEKQWTNKAVGDKLPECEAVCGKPKNPADAGQRILGGHLDAKGSFPWQAKMV
SRHNLTTGATLINEQWLLTTAKNLFLIHSENATVKDIAPTLTLYVGKKQLVEIEKVVLHP
NYSQVDIGLIKLKQKVPVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKYVM
LPVADQYNCIKHYEGSKCPKRKAPKSPVGEQPILNEHTFCAGMSKYQEDTCYGDAGTADM
EEDTWYAAGILSFDKSCGVAKYGVYVKVTSIQDWVQKTIAEN
Download sequence
Identical sequences ENSMMUP00000000907 9544.ENSMMUP00000000905 ENSMMUP00000000905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]