SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000980 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000980
Domain Number 1 Region: 458-745
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.95e-53
Family Eukaryotic proteases 0.0000275
Further Details:      
 
Domain Number 2 Region: 188-454
Classification Level Classification E-value
Superfamily vWA-like 1.1e-49
Family Integrin A (or I) domain 0.0000174
Further Details:      
 
Domain Number 3 Region: 84-144
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000806
Family Complement control module/SCR domain 0.00035
Further Details:      
 
Domain Number 4 Region: 150-206
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000153
Family Complement control module/SCR domain 0.00049
Further Details:      
 
Domain Number 5 Region: 24-92
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000131
Family Complement control module/SCR domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000980   Gene: ENSMMUG00000000729   Transcript: ENSMMUT00000001046
Sequence length 752
Comment pep:known chromosome:MMUL_1:4:31579939:31601696:1 gene:ENSMMUG00000000729 transcript:ENSMMUT00000001046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPLMVLFCLLFLYPGPADSATSCPQNVNISGGTFTLSHGWAPGSLLIYSCPQGLYPSPA
SRLCKSSGQWQTPRATRSLTKAVCKPVRCPAPVSFENGIYTPRLGSYPVGGNVSFECEDG
FILRGSPVRQCRPNGMWDGETAVCDNGAGHCPNPGISLGAVRTGSRFGHGDKVRYRCSSN
LVLTGSAERECQGNGVWSGTEPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQRTKES
LGRKIQIQRSGHLNLYLLLDSSQSVSENDFLIFKESASLMPLSIFSFEINVSVAIITFAS
EPKVLMSVLNVNSRDITEVISSLENAKYKDHENGTGTNTYAALNSVYLMMNNQMQLLGMK
TMAWQEIRHAIILLTDGKSNMGGSPKTAVDQIREILNINQKRNDYLDIYAIGVGKLDVDW
RELNELGSKKDGERHAFILQDTKALHQVFEHMLDVSKLTDTICGVGNMSANASDQERTPW
HVTIKPKSQETCRGALISDQWVLTAAHCFRDGNDHSLWRVNVGDPKSQWGKEFLIEKAVI
SPGFDVFAKKNQGILEFYGDDIALLKLAQKVKMSTHARPICLPCTMEANLALRRPQGSTC
RDHENELLNKQSVPAHFVALNGSKLNINLKMGVEWTSCAEVVSQEKTMFPNLTDVREVVT
DQFLCSGTQEDESPCKGESGGAVFLERRFRFFQVGLVSWGLYNPCLGSADKNSRKRAPRS
KVPPPRDFHINLFRMQPWLRQHLGDVLNFLPL
Download sequence
Identical sequences ENSMMUP00000025837 ENSMMUP00000000980 9544.ENSMMUP00000000980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]