SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000985 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000985
Domain Number 1 Region: 473-757
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.54e-60
Family Eukaryotic proteases 0.000000000154
Further Details:      
 
Domain Number 2 Region: 203-472
Classification Level Classification E-value
Superfamily vWA-like 3.71e-58
Family Integrin A (or I) domain 0.00000000241
Further Details:      
 
Domain Number 3 Region: 97-158
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000249
Family Complement control module/SCR domain 0.0000279
Further Details:      
 
Domain Number 4 Region: 164-220
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000612
Family Complement control module/SCR domain 0.0000253
Further Details:      
 
Domain Number 5 Region: 44-84
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000032
Family Complement control module/SCR domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000985   Gene: ENSMMUG00000000731   Transcript: ENSMMUT00000001051
Sequence length 763
Comment pep:known chromosome:MMUL_1:4:31602041:31608095:1 gene:ENSMMUG00000000731 transcript:ENSMMUT00000001051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSSLSPQLYLMPFILGLLSGGVTTTPLSSAQPQGSCSLEGVEIKGGSFRLLQEGQALEY
VCPSGFYPYPVQTRTCRSTGSWSTLQTQDRKTVKKAECRAIRCPRPQDFENGEYRPRSPY
YNVSDEISFHCYDGYTLRGSANRTCQVNGRWSGQTAICDNGAGYCSNPGIPIGTRKVGSR
YRLEDSVTYHCSRGLTLRGSQRRTCQEGGSWSGTEPSCQDSFMYDTPQEVAEAFLSSLTE
TIEGVDAEDGHSPGEQQKRRIILDPSGSMNIYLVLDGSDSIGAGNFTGAKKCLVNLIEKV
ASYGVKPRYALVTYATYPRIWVKVSDQESSNADWVTKKLSEINYEDHKLKSGTNTKRALQ
AVYSMMSWPEDIPPEGWNRTRHVIILMTDGLHNMGGDPITVIDEIRDLLYIGKDRKNPRE
DYLDVYVFGVGPLVDQVNINALASKKDNEQHVFKVKDMENLEDVFFQMIDESQSLSLCGM
VWEHSKGTDYHKQPWQAKISVTRPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVS
VGKKRDLEIEKVLFHPDYNISEKKEAGIPEFYDYDVALIKLKNKLNYDPTIRPICLPCTE
GTTRALRLPPTTTCQQQKEELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDAQ
YAPGYDKVKDISEVVTPRFLCTGGVSPYADPNTCRGDSGGPLIVHKRSRFIQVGVISWGV
VDVCKNQKRQKQVPAHARDFHVNLFQVLPWLKEKLQDEDLGFL
Download sequence
Identical sequences XP_014991515.1.72884 ENSMMUP00000000985 ENSMMUP00000000985 9544.ENSMMUP00000000985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]