SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000987 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000987
Domain Number 1 Region: 202-472
Classification Level Classification E-value
Superfamily vWA-like 1.44e-58
Family Integrin A (or I) domain 0.00000000241
Further Details:      
 
Domain Number 2 Region: 97-158
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000144
Family Complement control module/SCR domain 0.0000279
Further Details:      
 
Domain Number 3 Region: 164-220
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000347
Family Complement control module/SCR domain 0.0000253
Further Details:      
 
Domain Number 4 Region: 44-84
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000195
Family Complement control module/SCR domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000987   Gene: ENSMMUG00000000731   Transcript: ENSMMUT00000001054
Sequence length 510
Comment pep:known chromosome:MMUL_1:4:31602113:31606655:1 gene:ENSMMUG00000000731 transcript:ENSMMUT00000001054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSSLSPQLYLMPFILGLLSGGVTTTPLSSAQPQGSCSLEGVEIKGGSFRLLQEGQALEY
VCPSGFYPYPVQTRTCRSTGSWSTLQTQDRKTVKKAECRAIRCPRPQDFENGEYRPRSPY
YNVSDEISFHCYDGYTLRGSANRTCQVNGRWSGQTAICDNGAGYCSNPGIPIGTRKVGSR
YRLEDSVTYHCSRGLTLRGSQRRTCQEGGSWSGTEPSCQDSFMYDTPQEVAEAFLSSLTE
TIEGVDAEDGHSPGEQQKRRIILDPSGSMNIYLVLDGSDSIGAGNFTGAKKCLVNLIEKV
ASYGVKPRYALVTYATYPRIWVKVSDQESSNADWVTKKLSEINYEDHKLKSGTNTKRALQ
AVYSMMSWPEDIPPEGWNRTRHVIILMTDGLHNMGGDPITVIDEIRDLLYIGKDRKNPRE
DYLDVYVFGVGPLVDQVNINALASKKDNEQHVFKVKDMENLEDVFFQMIDESQSLSLCGM
VWEHSKGTDYHKQPWQAKISVTRPSKGHES
Download sequence
Identical sequences ENSMMUP00000000987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]