SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001033 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001033
Domain Number 1 Region: 148-191,311-480
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.6e-44
Family Tandem AAA-ATPase domain 0.0014
Further Details:      
 
Domain Number 2 Region: 30-265
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.05e-22
Family Tandem AAA-ATPase domain 0.006
Further Details:      
 
Domain Number 3 Region: 622-647
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000000863
Family Ran binding protein zinc finger-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001033   Gene: ENSMMUG00000000765   Transcript: ENSMMUT00000001102
Sequence length 1077
Comment pep:known chromosome:MMUL_1:13:116673997:116960542:1 gene:ENSMMUG00000000765 transcript:ENSMMUT00000001102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRVHNIKTSLTPHISCVTSESEKLLDFLPDRLRAKLLPFQKDGIIFALKRNGSVLKTKH
MGIDKTILKLGQLITLQESFPHFFVMPSALFFWAEAHGKYHPERKPEHFCYNQMVVDVWR
ISTSKVTVLGYGLLTADAETLIDALNNQNFKVVIVDESHYMKSRNATRSRILLPVVQKAR
RAILLTGTPALGRPEELFMQIEALFPQKFGRWTDYAKRYCNARIRYFGKRPQWDCRGASN
LNELHQLLSDIMIRRLKTEVLTQLPPKVRQRIPFDLPSAAAKELNTSFEEWEKIMRTPNS
GAMETVMGLITRMFKQTAIAKAGAVKDYIKMMLQNDSLKFLVFAHHLSMLQACTEAVIEN
KTRYIRIDGGVSSSERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAASHVVFAELYWDP
GHIKQAEDRAHRIGQCSSVNIHYLIANGTLDTLMWGMLNRKAQVTGSTLNGRKEKIQAEE
GDKEKWDFLQFAEAWTPNDSSEELRKEALFTHFEKEKQHDIRSFFLPQPKKRQLMTSCDE
SKRFPEENTVVSSDPTKTAAGDTIDYESDVEPETKRLKLATSDDHCSPSEEIPSQSREIR
TPLMESVQEAKAQSATPAFPVEGWQCRFCTYINNSVLPYCEMCENPQGSAVMQIDSLNHI
QDKNEDDSQKDTSKKVQTISDCEKKALAQSEPDQLADSKEETSKIEKEDGLTSQQGNEQL
KSSDTLPVYDTLMFCASRNTDRIHIYTKGGKQMSCNFIPLDIKLDLWEDLPASFQLKQNR
SLILRFVREWSSLTAMKQRIIRKSGQLFCSPILALEEITKQQTKQNCTKRYITKEDVAIA
SVDKVKNTGGHVRLITKESRPQDPFTKKFLEDGACVPFLNPYTVQAHLTVKPSTSKGYLQ
AVDNEGNPLCLHCQQPTCQTKQACKVNAWDSRFCSLKCQEEFWIRSNNSYLRAKVFETER
GVCQLCNVNAQELFLRLRDAPKSQRKKLLDATWTSKLPLEQLNEMIRNPGEGHFWQVDHI
KPVYGGGGQCSLDNLQTLCTVCHKERTARQAKERSQVRRQSLASKHGSDITRFLVKK
Download sequence
Identical sequences ENSMMUP00000001033 ENSMMUP00000001033 9544.ENSMMUP00000001033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]