SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001189 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001189
Domain Number 1 Region: 6-64
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000143
Family V set domains (antibody variable domain-like) 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001189   Gene: ENSMMUG00000000889   Transcript: ENSMMUT00000001268
Sequence length 72
Comment pep:novel chromosome:MMUL_1:19:49797645:49797863:-1 gene:ENSMMUG00000000889 transcript:ENSMMUT00000001268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMDLHQFITAYTIDTDTIIFGPAYSGRERVYSNASLLIQNVTRKDTGSYTIQIIKRGDKI
KRITGHFTLYRE
Download sequence
Identical sequences ENSMMUP00000001189 9544.ENSMMUP00000001189 ENSMMUP00000001189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]