SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001191 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001191
Domain Number 1 Region: 49-282
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2e-43
Family Voltage-gated potassium channels 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001191   Gene: ENSMMUG00000000892   Transcript: ENSMMUT00000001271
Sequence length 444
Comment pep:known_by_projection chromosome:MMUL_1:8:134710738:135053813:-1 gene:ENSMMUG00000000892 transcript:ENSMMUT00000001271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DEGQRRTPQGIGLLAKTPLTRPVKRNNAKYRRIQTLIYDALERPRGWALLYHALVFLIVL
GCLILAVLTTFKEYETVSGDWLLLLETFAIFIFGAEFALRIWAAGCCCRYKGWRGRLKFA
RKPLCMLDIFVLIASVPVVAVGNQGNVLATSLRSLRFLQILRMLRMDRRGGTWKLLGSAI
CAHSKELITAWYIGFLTLILSSFLVYLVEKDVPEVDAQGEEMKEEFETYADALWWGLITL
ATIGYGDKTPKTWEGRLIAATFSLIGVSFFALPAGILGSGLALKVQEQHRQKHFEKRRKP
AAELIQAAWRYYATNPNRIDLVATWRFYESVVSFPFFRQEEQLEAASSQKLGLLDRVRLS
NPRGSNTKGKLFTPLNVDAIEESPSKEPKPVGLNNKERFRTAFRMKAYAFWQSSEGNAFL
CPSLSPPLLPPPSPLPSSPLPLPT
Download sequence
Identical sequences ENSMMUP00000001191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]