SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001206 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001206
Domain Number 1 Region: 1-347
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 6.02e-73
Family ADP-ribosylglycohydrolase 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001206   Gene: ENSMMUG00000000900   Transcript: ENSMMUT00000001286
Sequence length 357
Comment pep:known chromosome:MMUL_1:2:39615529:39625967:1 gene:ENSMMUG00000000900 transcript:ENSMMUT00000001286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKYVAAMVLSAAGDSLGYYNGKWEFLQDGEKIHRQLAQLGGLDALDVGRWRVSDDTVMH
LATAEALVEAGKAPKLTQLYYLLAKHYQDCMEDMDGRAPGNASMHNAMQLKPGKPNGWRI
PFNSHEGGCGAAMRAMCIGLRFPHHSQLDTLIQVSIESGRMTHHHPTGYLGALASALFTA
YAVNARPPLQWGKGLMELLPEAKKYIVQSGYFVEENLQHWSYFQTKWENYLKLRGILDGE
SAPTFPEPFGVKERDQFYTSLSYSGWGGSSGHDAPMIAYDAVLAAGDSWKELAHRAFFHG
GDSDSTAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLGAKEDTVISL
Download sequence
Identical sequences A0A096MVP3 A0A2K6DAI0 F6REF0
ENSPANP00000003927 NP_001248110.1.72884 ENSMMUP00000001206 ENSMMUP00000001206 9544.ENSMMUP00000001206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]