SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001264 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001264
Domain Number 1 Region: 4-118
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.39e-21
Family Reprolysin-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001264   Gene: ENSMMUG00000031590   Transcript: ENSMMUT00000001345
Sequence length 125
Comment pep:known scaffold:MMUL_1:1099214767523:11:1169:1 gene:ENSMMUG00000031590 transcript:ENSMMUT00000001345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAELLRDPSLGAQFRVHLVKMVILTEPEGAPNITANLTSSLLSVCGWSRTINPEDDTDPG
HADLVLYITRFDLELPDGNRQVRGVTQLGGACSPTWSCLITEDTGFDLGVTIAHEIGHRY
AAPPA
Download sequence
Identical sequences ENSMMUP00000001264 9544.ENSMMUP00000001264 ENSMMUP00000001264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]