SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001332 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001332
Domain Number 1 Region: 29-164
Classification Level Classification E-value
Superfamily C-type lectin-like 3.15e-43
Family C-type lectin domain 0.000000192
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001332   Gene: ENSMMUG00000000991   Transcript: ENSMMUT00000001415
Sequence length 166
Comment pep:known chromosome:MMUL_1:13:79522922:79525532:1 gene:ENSMMUG00000000991 transcript:ENSMMUT00000001415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQTGSYFMLISCLMFLSQSQGQEAQTDLPQARISCPEGSNAYGSYCYYFNEDRETWVDA
DLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWTGLHDPKKNRRWHWSSGSLFS
YKSWDIGAPNSINPGYCVSLTSSSGFRKWKDVPCEDKFSFVCKFKN
Download sequence
Identical sequences F6SRA5
XP_014968213.1.72884 ENSMMUP00000001332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]