SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001372 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001372
Domain Number 1 Region: 230-323
Classification Level Classification E-value
Superfamily Immunoglobulin 3e-30
Family C1 set domains (antibody constant domain-like) 0.00000812
Further Details:      
 
Domain Number 2 Region: 119-223
Classification Level Classification E-value
Superfamily Immunoglobulin 3.16e-28
Family C1 set domains (antibody constant domain-like) 0.00000358
Further Details:      
 
Domain Number 3 Region: 7-113
Classification Level Classification E-value
Superfamily Immunoglobulin 3.38e-25
Family C1 set domains (antibody constant domain-like) 0.00000569
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001372   Gene: ENSMMUG00000001022   Transcript: ENSMMUT00000001458
Sequence length 331
Comment pep:known scaffold:MMUL_1:1099214738724:2913:4619:-1 gene:ENSMMUG00000001022 transcript:ENSMMUT00000001458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AASTKGPSVFPLASCSRSTSQSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYVCNVVHEPSNTKVDKRFTPPCGDTTPPCPPCPAPELLG
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGAEVHNAQTKPRERQF
NSTYRVVSVLTVTHQDWLNGKEYTCKVSNKGLPAPIEKTISKAKGQPREPQVYILPPPQE
ELTKNQVSLTCLVTGFYPSDIAVEWESNGQPENTYKTTPPVLDSDGSYFLYSKLIVDKSR
WQQGNTFSCSVMHEALHNHYTQKSLSVSPGK
Download sequence
Identical sequences ENSMMUP00000001372 9544.ENSMMUP00000001372 ENSMMUP00000001372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]