SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001373 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001373
Domain Number 1 Region: 95-188
Classification Level Classification E-value
Superfamily Immunoglobulin 1.32e-30
Family C1 set domains (antibody constant domain-like) 0.00000948
Further Details:      
 
Domain Number 2 Region: 3-88
Classification Level Classification E-value
Superfamily Immunoglobulin 2.01e-22
Family C1 set domains (antibody constant domain-like) 0.0000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001373   Gene: ENSMMUG00000031247   Transcript: ENSMMUT00000001459
Sequence length 196
Comment pep:novel scaffold:MMUL_1:1099214789567:367:1113:-1 gene:ENSMMUG00000031247 transcript:ENSMMUT00000001459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISRTPEVTCVVVDVSQEDPEVQFNWYVDGAEVHHAETKPRERQFNSTYRVVSVLTVTHQ
DWLNGKEYTCKVSNKGLPAPIEKTISKAKGQPREPQVYILPPPQEELTKNQVSLTCLVTG
FYPSDIAVEWESNGQPENTYKTTPPMLDSDGSYLLYSKLTVNKSRWQPGNIFTCSVMHEA
LHNHYTQKSLSVSPGK
Download sequence
Identical sequences ENSMMUP00000001373 ENSMMUP00000001373 9544.ENSMMUP00000001373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]