SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001609 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001609
Domain Number 1 Region: 298-557
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.37e-73
Family Eukaryotic proteases 0.00012
Further Details:      
 
Domain Number 2 Region: 174-279
Classification Level Classification E-value
Superfamily Kringle-like 3.87e-32
Family Kringle modules 0.00031
Further Details:      
 
Domain Number 3 Region: 73-120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000381
Family EGF-type module 0.014
Further Details:      
 
Domain Number 4 Region: 113-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000247
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001609   Gene: ENSMMUG00000001207   Transcript: ENSMMUT00000001708
Sequence length 562
Comment pep:known_by_projection chromosome:MMUL_1:9:113217854:113254980:1 gene:ENSMMUG00000001207 transcript:ENSMMUT00000001708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFARMSDLHVLLLMALVGKTACGFSLMSLLESLDPDWTPDQYDYSYEDYNPEENTSSTLT
HPENPDWYYTEDQADPCQPNPCEHGGDCLVHGRTFTCSCLAPFSGNKCQKVQNTCKDNPC
GRGQCLITQSPPYYRCVCKHPYTGPSCSQVVPVCRPNPCQNSGTCSRHKRRSKFTCACPD
QFKGKFCEIGSDDCYVGDGYSYRGKMNRTVNQHACLYWNSHLLLQENYNMFMEDAETHGI
GEHNFCRNPDADEKPWCFIRVSNDKVKWEYCDVSACAAQDIAYPEEIPTEPSTKLLGFDS
CGKTEIAERKIKRIYGGFKSTAGKHPWQASLQSSLPLTVSMPQGHFCGGALIHPCWVLTA
AHCTDIKTRHLKVVLGDQDLKKEEFHEQSFRVEKIFKYTHYNERDEIPHNDIGKALLKLK
PVDGHCALESKYVKTVCLPDGSFPSGSECHISGWGVTETGKGSRQLLDAKVKLISNTLCN
SRQLYDHMIDDSMICAGNLQKPGQDTCQGDSGGPLTCEKDGTYYVYGIVSWGLECGTRPG
VYTQVTKFLNWIKATIKSESGF
Download sequence
Identical sequences ENSMMUP00000001609 ENSMMUP00000001609 9544.ENSMMUP00000001609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]